General Information

  • ID:  hor002361
  • Uniprot ID:  Q2VF17(64-81)
  • Protein name:  MMG2-DPa
  • Gene name:  MMG2
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Myomodulin family
  • Source:  animal
  • Expression:  Expressed in the pedal-buccal projection neurons in the pedal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GGSLDALRSGHQVPMLRA
  • Length:  18(64-81)
  • Propeptide:  MWKILETCSCFLVVAVLSGLGKAQPESFSGSAVTDDSTSGANKRGWSMLRLGRGLQMLRLGKRGGSLDALRSGHQVPMLRAGRGSPDTSGRLDANELYAVLSAILDEPRDQSRRQPPLPRYGRDNNGVARDLLDALASDGESSSNFDLLSSLNNGPSYFRPAPRGGRYKRSLPDAGPADYPSLEDYLVQSRQFARPYSSRAVALPRIGRFSGSPRLQAKAVPRPRIGRQESQMREAKSAE
  • Signal peptide:  MWKILETCSCFLVVAVLSGLGKA
  • Modification:  T18 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bias egestive feeding programs toward ingestive ones, and modulate accessory radula closer (ARC) muscle contractions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2VF17-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002361_AF2.pdbhor002361_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 216856 Formula: C78H133N27O24S
Absent amino acids: CEFIKNTWY Common amino acids: GL
pI: 10.4 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -13.89 Boman Index: -2797
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 92.22
Instability Index: 6443.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16237168
  • Title:  Identification of a New Neuropeptide Precursor Reveals a Novel Source of Extrinsic Modulation in the Feeding System of Aplysia